- EVI5 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-82596
- EVI5
- Human, Mouse
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: MVTNKMTAAF RNPSGKQVAT DKVAEKLSST LSWVKNTVSH TVSQMASQVA SPSTSLHTTS SSTTLSTPAL SPSSPSQLSP D
- EVI-5, NB4S
- ecotropic viral integration site 5
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
MVTNKMTAAFRNPSGKQVATDKVAEKLSSTLSWVKNTVSHTVSQMASQVASPSTSLHTTSSSTTLSTPALSPSSPSQLSPD
Specifications/Features
Available conjugates: Unconjugated